PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G05790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 277aa    MW: 31376.3 Da    PI: 8.3045
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G05790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding249.1e-083075346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + +  +   +W ++a++++ g+t  ++   + k
      AT5G05790.1 30 SWTKEENKKFERALAVYADDtpdRWFKVAAMIP-GKTISDVMRQYSK 75
                     7*****************99*************.******9998877 PP

2Myb_DNA-binding409.3e-13132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
      AT5G05790.1 132 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVGSKTPTQVASHAQKY 176
                      8****************************999************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.1322679IPR017884SANT domain
SMARTSM007171.2E-72779IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.600.0012774IPR009057Homeodomain-like
SuperFamilySSF466896.96E-112983IPR009057Homeodomain-like
CDDcd001672.01E-73076No hitNo description
PfamPF002491.0E-63075IPR001005SANT/Myb domain
PROSITE profilePS5129418.108125181IPR017930Myb domain
SuperFamilySSF466891.08E-15127180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-16129180IPR006447Myb domain, plants
SMARTSM007179.9E-11129179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-11129181IPR009057Homeodomain-like
CDDcd001677.65E-10132176No hitNo description
PfamPF002494.0E-10132176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
METLHPLLSH VPTSDHRFVV QEMMCLQSSS WTKEENKKFE RALAVYADDT PDRWFKVAAM  60
IPGKTISDVM RQYSKLEEDL FDIEAGLVPI PGYRSVTPCG FDQVVSPRDF DAYRKLPNGA  120
RGFDQDRRKG VPWTEEEHRR FLLGLLKYGK GDWRNISRNF VGSKTPTQVA SHAQKYYQRQ  180
LSGAKDKRRP SIHDITTVNL LNANLSRPSS DHGCLVSKQA EPKLGFTDRD NAEEGVMFLG  240
QNLSSVFSSY DPAIKFSGAN VYGEGGYCIS QDLETRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1631961176RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.329520.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425676730.0
Genevisible250741_at0.0
Expression AtlasAT5G05790-
AtGenExpressAT5G05790-
ATTED-IIAT5G05790-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G05790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G05790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195310.0AY519531.1 Arabidopsis thaliana MYB transcription factor (At5g05790) mRNA, complete cds.
GenBankBT0260540.0BT026054.1 Arabidopsis thaliana At5g05790 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196198.10.0duplicated SANT DNA-binding domain-containing protein
SwissprotQ8S9H78e-73DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ9FFJ90.0Q9FFJ9_ARATH; At5g05790
STRINGAT5G05790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Representative plantOGRP27517122
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  3. Machemer K, et al.
    Interplay of MYB factors in differential cell expansion, and consequences for tomato fruit development.
    Plant J., 2011. 68(2): p. 337-50
    [PMID:21707804]